PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0118200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 289aa    MW: 29448.6 Da    PI: 6.761
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0118200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.25.5e-363185559
          zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                    a +cprC s+ntkfCyynny+l+qPr+fCkaCrryWt GG+lrnvPvGg++r+  
  Spipo2G0118200 31 AERCPRCGSQNTKFCYYNNYNLAQPRHFCKACRRYWTVGGSLRNVPVGGSTRRPA 85
                    679*************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-213083IPR003851Zinc finger, Dof-type
PfamPF027015.4E-313184IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.5873286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MKGSMRVSSS SDGGERRVAA GAEPLACGGE AERCPRCGSQ NTKFCYYNNY NLAQPRHFCK  60
ACRRYWTVGG SLRNVPVGGS TRRPAAPHQS KPQISPDHPI TSPAKPLRRR PAPALASAAS  120
SPSSSCSSSP PLGSLASVSA PAAPSVAKFE ADGSDEPGGP IDAVRCFESL LGEPLPAGFL  180
ALGDPFLGGH DGFALGLGLG GHGGAAADIV DEMSFGSERG ASAWPFFEDD GGAIVGGGNN  240
AGTSDRIGGE HDAWRAVAGE SELVRGDGGE YCGWPDPAAP ATRGKRVQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047919e-31AP004791.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0491D10.
GenBankAP0149629e-31AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.15e-28OBF binding protein 1